Molecular Characteristics
Complete Specifications
Structural Composition
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Physical Properties
IGF-1 LR3 (Long-Arg3-IGF-1) is a synthetic 83-amino-acid analog of human insulin-like growth factor 1, carrying an arginine substitution at position 3 of the native IGF-1 sequence and a 13-residue N-terminal extension. The protein contains three disulfide bridges; lyophilized storage under cold, dry conditions with protection from moisture and light, and minimal freeze–thaw cycling, is recommended to preserve structural integrity during research applications.
Analysis & Documentation
Identity
Each production lot is checked against the reference structure recorded for this compound:
- Classification — Synthetic 83-amino-acid analog of human IGF-1 (Long-Arg3-IGF-1)
- Molecular formula — C₄₀₀H₆₁₉N₁₁₁O₁₁₅S₉
- Expected mass — ~9,111 Da (with three disulfide bonds)
- CAS registry — 143045-27-6
- Chain length — 83 amino acids (three disulfide bonds)
- PubChem CID — Not applicable (synthetic protein; not indexed as a PubChem compound)
Analytical Methods
Testing is carried out per lot by an independent laboratory. The methods measure what the material is and how much of it is the target compound:
- RP-HPLC — reverse-phase separation of the target from process-related impurities; purity is reported as area percent of the main peak
- Mass spectrometry — observed mass compared against the expected molecular mass above
- Retention time — compared against a reference standard run under the same conditions
- Chromatogram — reproduced on the certificate so the peak and any shoulders can be inspected directly
Material & Documentation
What arrives, and how to tie it back to its paperwork:
- Appearance as supplied — White to off-white lyophilized powder
- Solubility — Water, buffered aqueous solutions (e.g., PBS)
- Lot number — printed on the container label and used to look up the certificate
- Certificate — indexed by lot at Certificates of Analysis
Laboratory Handling and Storage Protocols
Lyophilized Powder Storage
- Store at –20°C to –80°C in the original, sealed vial
- Protect from light exposure and moisture
- A desiccated storage environment is recommended
- Stability data suggests extended stability when stored at −20 °C or below.
Stability Characteristics
IGF-1 LR3 is a modified synthetic peptide research compound designed for enhanced stability relative to native IGF-1. When handled under standard peptide laboratory protocols, including proper cold storage and careful reconstitution, it maintains structural integrity and solubility. Minimizing mechanical agitation and freeze–thaw exposure supports consistent performance in in vitro and analytical research applications.
Frequently Asked Questions
What is IGF-1 LR3?
IGF-1 LR3 (Long-Arg3-IGF-1) is a synthetic 83-amino-acid analogue of human IGF-1 with three disulfide bonds (molecular formula C₄₀₀H₆₁₉N₁₁₁O₁₁₅S₉, molecular weight ~9,111 Da). It is supplied as a white to off-white lyophilized powder.
How is IGF-1 LR3 supplied?
IGF-1 LR3 is typically supplied as a lyophilized (freeze-dried) powder in sealed research vials to maintain stability during storage and shipment.
How should lyophilized IGF-1 LR3 be stored?
Lyophilized IGF-1 LR3 should be stored:
-
Long-term: −20 °C to −80 °C
-
Short-term: 2–8 °C
Keep vials sealed and protected from light and moisture until use.
Does IGF-1 LR3 require a Certificate of Analysis (COA)?
Yes. A Certificate of Analysis (COA) should be available for each batch of IGF-1 LR3, verifying identity, purity, and analytical testing results to ensure research quality and traceability.
Is IGF-1 LR3 FDA-approved?
No. IGF-1 LR3 is not FDA-approved as a drug, supplement, or therapeutic product. It is sold exclusively as a research compound and must not be marketed or used for diagnostic, therapeutic, or consumption purposes.
This product is not for human consumption. It is sold strictly for research and educational purposes and is not intended to diagnose, treat, cure, or prevent any disease.
Any clinical data or research information referenced on this page is derived from peer-reviewed scientific literature and official publications. This information is provided for educational reference only and does not constitute medical advice or product claims.
By purchasing this product, you acknowledge that you are a qualified researcher and agree to use it in full compliance with all applicable laws and regulations.
