Molecular Characteristics
Complete Specifications
-
CAS Registry Number: Not assigned (endogenous antimicrobial peptide)
-
PubChem CID: Not available
-
Peptide Classification: Synthetic 37-amino-acid antimicrobial peptide (cathelicidin family)
-
Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃
-
Molecular Weight: ~4,493.3 Da
Structural Composition
-
Amino Acid Sequence:
[LL-37, 37 aa] -
Length: 37 amino acids
Physical Properties
-
Appearance: White to off-white lyophilized powder
-
Solubility: Water, bacteriostatic water, buffered aqueous solutions (e.g., PBS)
Structural & Stability Notes
LL-37 is a 37-amino-acid synthetic peptide derived from the human cathelicidin antimicrobial peptide family. Its amphipathic alpha-helical structure contributes to characteristic physicochemical properties under laboratory conditions. The peptide contains multiple positively charged residues, supporting aqueous solubility and interaction with negatively charged biomolecules. Due to its length and structural complexity, proper lyophilized storage and protection from moisture, light exposure, and repeated freeze–thaw cycles are important for maintaining structural integrity and analytical consistency during research applications.






Reviews
There are no reviews yet.