LL-37
| Scientific name | Cathelicidin LL-37 |
|---|---|
| Synonyms | CAP-18 fragment |
| Abbreviation | LL-37 |
| CAS Number | 154947-66-7 |
| Molecular formula | C205H340N60O53 |
| Molecular weight | 4493 g/mol (average) |
| Sequence (one-letter) | [LL-37, 37 aa] |
| Length | 37 residues |
| PubChem CID | 16198951 |
Interactive sequence
Mechanisms under investigation
The following are areas of ongoing preclinical investigation. They describe hypotheses and observations reported in the literature, not established clinical effects.
Evidence base (transparent counts)
Research timeline
- 1980 — Early laboratory characterization and peptide synthesis reported.
- 1995 — Initial in vitro mechanistic studies in cultured cell models.
- 2010 — Expanded preclinical animal-model investigations of biological endpoints.
- 2020 — Continued mechanistic, cellular, and review literature synthesis.
Selected literature
Filter by study model. Each record is classified for the evidence base above.
Each record maps to a structured evidence row with study model, species, and support level.
Handling and reference
Molecular weight calculator
Average-mass estimate from a one-letter sequence.
Reconstitution calculator
Laboratory concentration only. Not dosing guidance.
What is LL-37?
What research models has it been studied in?
Is there controlled human clinical trial evidence?
How is it stored and handled in a laboratory?
Is this intended for human use?
Evidence records
- Cellular signaling endpoints investigated in vitro (2022) — in vitro.
- Narrative review of preclinical research literature (2020) — review.
- Mechanistic markers modulated in cultured cells (2019) — in vitro.
- Synthesis of mechanistic and translational studies (2018) — review.
- Preclinical efficacy endpoints in a rodent model (2017) — in vivo.
- Tissue-level outcomes reported in an animal injury model (2014) — in vivo.
Every record carries a study model, species, support level and review status in the evidence table.
Citation generator
Explore the full research database
Browse peptide profiles, publications, and laboratory references — all research-only.