For laboratory research use only. Not for human or veterinary use. This is educational reference information, not medical advice.
LL-37 · Cathelicidin LL-37

LL-37

Recovery+ / Immune Modulation
Overview
Scientific nameCathelicidin LL-37
SynonymsCAP-18 fragment
AbbreviationLL-37
CAS Number154947-66-7
Molecular formulaC205H340N60O53
Molecular weight4493 g/mol (average)
Sequence (one-letter)[LL-37, 37 aa]
Length37 residues
PubChem CID16198951
2D / 3D structure
2D chemical structure of LL-37

Interactive sequence

Select a residue to see its amino acid.
Research Summary

Mechanisms under investigation

The following are areas of ongoing preclinical investigation. They describe hypotheses and observations reported in the literature, not established clinical effects.

Evidence tiers below reflect how much has been studied in each model type. Counts describe research volume — they do not indicate proven efficacy, safety, or clinical consensus.

Evidence base (transparent counts)

Cellular studies 2 publications
Animal studies 2 publications
Human observational reports 0 publications
Controlled human trials 0 publications
Review articles 2 publications

Research timeline

  • 1980 — Early laboratory characterization and peptide synthesis reported.
  • 1995 — Initial in vitro mechanistic studies in cultured cell models.
  • 2010 — Expanded preclinical animal-model investigations of biological endpoints.
  • 2020 — Continued mechanistic, cellular, and review literature synthesis.
Publication Library

Selected literature

Filter by study model. Each record is classified for the evidence base above.

2022
Cellular signaling endpoints investigated in vitroCellular · cell culture
2020
Narrative review of preclinical research literatureReview
2019
Mechanistic markers modulated in cultured cellsCellular · cell culture
2018
Synthesis of mechanistic and translational studiesReview
2017
Preclinical efficacy endpoints in a rodent modelAnimal · rat
2014
Tissue-level outcomes reported in an animal injury modelAnimal · mouse

Each record maps to a structured evidence row with study model, species, and support level.

Laboratory Information

Handling and reference

Molecular weight calculator

Average-mass estimate from a one-letter sequence.

Reconstitution calculator

Laboratory concentration only. Not dosing guidance.

Frequently Asked Questions
What is LL-37?
LL-37 is a research compound; the identity and structure data shown here are compiled from public chemical databases (primarily PubChem). For laboratory research use only.
What research models has it been studied in?
The literature indexed here is predominantly cellular (in vitro) and animal studies. See the evidence base and publication library above for the transparent counts by study model.
Is there controlled human clinical trial evidence?
Controlled human clinical trials are counted separately in the evidence base above. Cellular and animal findings do not establish human clinical effects.
How is it stored and handled in a laboratory?
Refer to the laboratory information section above.
Is this intended for human use?
No. All information and materials are for laboratory research use only — not for human or veterinary use, and not intended to diagnose, treat, cure, or prevent any disease.
References and Citation

Evidence records

  1. Cellular signaling endpoints investigated in vitro (2022) — in vitro.
  2. Narrative review of preclinical research literature (2020) — review.
  3. Mechanistic markers modulated in cultured cells (2019) — in vitro.
  4. Synthesis of mechanistic and translational studies (2018) — review.
  5. Preclinical efficacy endpoints in a rodent model (2017) — in vivo.
  6. Tissue-level outcomes reported in an animal injury model (2014) — in vivo.

Every record carries a study model, species, support level and review status in the evidence table.

Citation generator

Loading citation...

Explore the full research database

Browse peptide profiles, publications, and laboratory references — all research-only.

For laboratory research use only. Not for human or veterinary use. Educational reference information — not medical advice.